PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009769625.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 362aa    MW: 39444.6 Da    PI: 6.5195
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009769625.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44.2e-10162217560
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                     kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l   +     l+
  XP_009769625.1 162 KRAKRILANRQSAARSKERKARYISELESKVQTLQTEATTLSAQLTLFQRDTTGLT 217
                     9****************************************999887766665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-16158222IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.668160223IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.36E-11162213No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-10162216No hitNo description
PfamPF001701.3E-8162210IPR004827Basic-leucine zipper domain
CDDcd147031.14E-21163212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MQDPSHLNSV KLPNQPPSSF SAAAFRPSHH RRAHSEVNFR LPEDLDLESD PFDAPAGSFE  60
EIGSEDDFFS TYMDIEKLGS GGGSNSGSDA AAGGLENAGG SGGSSRVGAE SSDGEKSMMM  120
KPRHRHSHSV DSSSSLLLSE SIEAKKAMAP DKLAELWTID PKRAKRILAN RQSAARSKER  180
KARYISELES KVQTLQTEAT TLSAQLTLFQ RDTTGLTNEN TELKLRLQAM EQQAQLRDAR  240
NEALKQEVER LKIATGQISA SSDAYNSGMQ QISYNRPAFF PHQPQPGPSE PPNTLMPQFH  300
TLQGSMSNPR HTLLAGHAQA LTDAMQQDPL RRFQGLDINS RGSHLVKTEA PSISASESSS  360
TF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754461e-117HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769625.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-104RF2B_ORYSJ; Transcription factor RF2b
TrEMBLK4C5F00.0K4C5F0_SOLLC; Uncharacterized protein
STRINGSolyc06g049040.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34252349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-90bZIP family protein